Recombinant Mouse Ccl7 protein

• Cat.No.: Ccl7-618M
• Product Overview: Recombinant Mouse Ccl7 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 74
• Description: Murine CCL7, also known as MARC, is belonging to the CC chemokine family. It is encoded by the gene CCL7 and was isolated from a mouse mast cell line after Fc epsilon RI triggering by IgE plus antigen. Sequence comparisons suggest that MARC may be the mouse homologue of the human MCP-3 gene. Similar to the human system, MARC/FIC is postulated the murine MCP-3. The MCP-3 protein family signals through CCR2 expect MCP-1 and possess cross-reacts across species. CCL7/MCP3 has chemotactic function for monocytes and eosinophils, but not for neutrophils.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2× PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human monocytes is in a concentration range of 100-300 ng/ml.
• Molecular Mass: Approximately 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
• Endotoxin: Less than 1 EU/µg of rMuMCP-3/CCL7 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl7
• Official Symbol: Ccl7
• Synonyms: CCL7; chemokine (C-C motif) ligand 7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; small inducible cytokine A7; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3; fic; marc; mcp3; MCP-3; Scya7
• Gene ID: 20306
• mRNA Refseq: NM_013654
• Protein Refseq: NP_038682
• UniProt ID: Q03366