Recombinant Mouse Ccl22 protein

Cat.No. : Ccl22-91M
Product Overview : Recombinant Mouse Ccl22 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 68
Description : CCL22 is a protein that in mouse is encoded by the CCL22 gene, which locates on the Chr. 8. It is highly expressed in macrophage, monocyte-derived dendritic cell and thymus, additionally, also detected in the tissues of thymus, lymph node and appendix. CCL22 can bind to CCR4, and is a chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells, but not for neutrophils, eosinophils, and resting T-lymphocytes. After secreted from monocyte-derived dendritic cells, the protein can be proteolytic cleaved into three forms: MDC (3-69), MDC (5-69), MDC (7-69).
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human activated lymphocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 7.8 kDa, a single, non-glycosylated polypeptide chain containing 68 amino acids.
AA Sequence : GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Endotoxin : Less than 1 EU/μg of rMuMDC/CCL22 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl22
Official Symbol Ccl22
Synonyms CCL22; chemokine (C-C motif) ligand 22; C-C motif chemokine 22; CC chemokine ABCD-1; small-inducible cytokine A22; activated B and dendritic cell-derived; small inducible cytokine subfamily A22; dendritic cell and B cell derived chemokine; small inducible cytokine subfamily A, member 22; SMALL INDUCIBLE CYTOKINE A22 PRECURSOR (CC CHEMOKINE ABCD-1) (ACTIVATED B AND DENDRITIC CELL-DERIVED); MDC; DCBCK; ABCD-1; Scya22;
Gene ID 20299
mRNA Refseq NM_009137
Protein Refseq NP_033163
UniProt ID O88430

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl22 Products

Required fields are marked with *

My Review for All Ccl22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon