Recombinant Mouse Ccl2 Protein, His-tagged

• Cat.No.: Ccl2-7335M
• Product Overview: Recombinant mouse CCL2 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 16 kDa
• Protein length: 24-148
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: In PBS (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl2
• Synonyms: Ccl2; chemokine (C-C motif) ligand 2; JE; MCA; MCP; Scy; Sig; HC11; MCAF; MCP-; MCP1; MCP-1; SMC-C; Scya2; Sigje; SMC-CF; AI323594; C-C motif chemokine 2; monocyte chemoattractant protein 1; monocyte chemotactic protein 1; platelet-derived growth factor-inducible protein JE; small-inducible cytokine A2
• Gene ID: 20296
• mRNA Refseq: NM_011333
• Protein Refseq: NP_035463
• UniProt ID: P10148