Recombinant Mouse Ccl2 Protein, His-tagged

Cat.No. : Ccl2-7335M
Product Overview : Recombinant mouse CCL2 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 24-148
Description : This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.
Form : Liquid
Molecular Mass : 16 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : In PBS (pH 7.4) containing 10 % glycerol.
Gene Name Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus (house mouse) ]
Official Symbol Ccl2
Synonyms Ccl2; chemokine (C-C motif) ligand 2; JE; MCA; MCP; Scy; Sig; HC11; MCAF; MCP-; MCP1; MCP-1; SMC-C; Scya2; Sigje; SMC-CF; AI323594; C-C motif chemokine 2; monocyte chemoattractant protein 1; monocyte chemotactic protein 1; platelet-derived growth factor-inducible protein JE; small-inducible cytokine A2
Gene ID 20296
mRNA Refseq NM_011333
Protein Refseq NP_035463
UniProt ID P10148

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl2 Products

Required fields are marked with *

My Review for All Ccl2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon