Recombinant Mouse BTLA Protein, Fc-tagged

• Cat.No.: BTLA-613M
• Product Overview: Recombinant Mouse BTLA protein with Fc tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Protein Length: 305
• Description: Enables signaling receptor activity. Acts upstream of or within immune response-regulating cell surface receptor signaling pathway; negative regulation of B cell proliferation; and negative regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Orthologous to human BTLA (B and T lymphocyte associated).
• Form: Lyophilized
• Molecular Mass: 42.7 kDa
• AA Sequence: MKTVPAMLGTPRLFREFFILHLGLWSILCEKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPGRTWLLYTLLPLGALLLLLACVCLLCFLKRIQGKEKKPSDLAGRDTNLVDIPASSRTNHQALPSGTGIYDNDPWSSMQDESELTISLQSERNNQGIVYASLNHCVIGRNPRQENNMQEAPTEYASICVRS
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Btla B and T lymphocyte associated [ Mus musculus (house mouse) ]
• Official Symbol: BTLA
• Synonyms: BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; A630002H24; MGC124217; MGC124218
• Gene ID: 208154
• mRNA Refseq: NM_001037719
• Protein Refseq: NP_001032808
• UniProt ID: Q7TSA3