Recombinant Mouse ATP5G1 Protein, His-tagged

• Cat.No.: ATP5G1-2135M
• Product Overview: Recombinant Mouse ATP5G1 Protein(NP_001154891.1), fused to His-tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Lyophilized from 20 mM Tris-HCl, 0.15M NaCl, 0.05%Brij78, 6% Trehalose, pH 8.0.
  The volume before lyophilization is 20μl/vial
• Molecular Mass: The protein has a calculated MW of 18 kDa.
• AA Sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
• Purity: ≥85%, by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Atp5g1 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [ Mus musculus (house mouse) ]
• Official Symbol: ATP5G1
• Synonyms: Atp5mc1
• Gene ID: 11951
• mRNA Refseq: NM_001161419.1
• Protein Refseq: NP_001154891.1
• UniProt ID: Q9CR84