Recombinant Mouse ATP2B1 Protein, His-tagged
Cat.No. : | ATP2B1-11M |
Product Overview : | Recombinant Mouse ATP2B1 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Predicted to enable P-type calcium transporter activity involved in regulation of presynaptic cytosolic calcium ion concentration and PDZ domain binding activity. Involved in several processes, including negative regulation of cytosolic calcium ion concentration; positive regulation of bone mineralization; and regulation of vascular associated smooth muscle contraction. Located in basolateral plasma membrane and immunological synapse. Is integral component of presynaptic membrane and integral component of synaptic vesicle membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Orthologous to human ATP2B1 (ATPase plasma membrane Ca2+ transporting 1). |
Form : | 50mM Tris, 0.3 M NaCl, 0.05% SKL, 1mM DTT, pH9.0. |
Molecular Mass : | 13.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGDMANNSVAYSGVKNSLKEANHDGDFGITLTELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEA |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.15 mg/ml |
Gene Name | Atp2b1 ATPase, Ca++ transporting, plasma membrane 1 [ Mus musculus (house mouse) ] |
Official Symbol | ATP2B1 |
Synonyms | Pmca1; 2810442I22Rik; E130111D10Rik |
Gene ID | 67972 |
mRNA Refseq | NM_001359506 |
Protein Refseq | NP_001346435 |
MIM | 108731 |
UniProt ID | G5E829 |
◆ Recombinant Proteins | ||
ATP2B1-120H | Recombinant Human ATP2B1 protein, His-tagged | +Inquiry |
ATP2B1-972H | Recombinant Human ATP2B1 protein, GST-tagged | +Inquiry |
ATP2B1-11M | Recombinant Mouse ATP2B1 Protein, His-tagged | +Inquiry |
ATP2B1-861R | Recombinant Rat ATP2B1 Protein | +Inquiry |
ATP2B1-127H | Recombinant Human ATPase, Ca++ transporting, plasma membrane 1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP2B1 Products
Required fields are marked with *
My Review for All ATP2B1 Products
Required fields are marked with *
0
Inquiry Basket