Recombinant Mesocricetus auratus PRNP protein
Cat.No. : | PRNP-97M |
Product Overview : | Recombinant Mesocricetus auratus PRNP protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mesocricetus auratus |
Source : | E.coli |
Description : | prion protein |
Form : | Liquid. In 10 mM sodium acetate pH 4.5 and 0.02 % sodium azide. |
Molecular Mass : | ~24 kDa |
AA Sequence : | MHHHHHHKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHNQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKESQAYYDGRRS |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20-80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.58 mg/ml |
Gene Name | LOC101829062 prion protein [ Mesocricetus auratus (golden hamster) ] |
Official Symbol | LOC101829062 |
Synonyms | CJD; GSS; PrP; ASCR; KURU; PRIP; PrPc; CD230; AltPrP; p27-30; PrP27-30; PrP33-35C |
Gene ID | 101829062 |
mRNA Refseq | XM_013112401 |
Protein Refseq | XP_012967855 |
UniProt ID | P04273 |
◆ Recombinant Proteins | ||
Macrod2-3893M | Recombinant Mouse Macrod2 Protein, Myc/DDK-tagged | +Inquiry |
Chkb-1726M | Recombinant Mouse Chkb protein, His-tagged | +Inquiry |
HLA-DPA1-3582HF | Recombinant Full Length Human HLA-DPA1 Protein, GST-tagged | +Inquiry |
UBL4A-4888R | Recombinant Rhesus Macaque UBL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAT1-2422H | Recombinant Human FAT1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS3-909HCL | Recombinant Human TMPRSS3 293 Cell Lysate | +Inquiry |
EPN1-6581HCL | Recombinant Human EPN1 293 Cell Lysate | +Inquiry |
MEF2C-4375HCL | Recombinant Human MEF2C 293 Cell Lysate | +Inquiry |
BIRC8-171HCL | Recombinant Human BIRC8 cell lysate | +Inquiry |
CDH5-1201RCL | Recombinant Rat CDH5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LOC101829062 Products
Required fields are marked with *
My Review for All LOC101829062 Products
Required fields are marked with *
0
Inquiry Basket