Recombinant Lentinus edodes mnp2c protein, His&Myc-tagged
Cat.No. : | mnp2c-3688L |
Product Overview : | Recombinant Lentinus edodes mnp2c protein(B5U994)(21-377aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lentinus edodes |
Source : | E.coli |
Tag : | His&Myc |
ProteinLength : | 21-377aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | APAAQNARCSDGTVVPNSICCDFIPLAQDLTETLFENQCGETAHEVLRLSFHDAIAISQSLGPSAGGGADGSMLIFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCPGAPQLEFRAGRPNATAPAVDGLIPEPQNTVDEILARFQDAANMNAEDIVSLLVSHTVARADHVDPTLDAAPFDSTPFTFDSQFFLETLLTGVGFPGTTNNTGEVSSPLPLTVGDNVGELRLQSDFELARDSRTACFWQSMINQEALMASRFKAAMAKMAVIGHNANDLIDCSAVVPKPVPALNKPATFPATKTKADVQQACPEPFPNLTTDRAPRETEIPHCPDNEATCTS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Native Proteins | ||
Thrombin-22H | Active Native Human Thrombin Protein | +Inquiry |
Lectin-1794A | Active Native Artocarpus integrifolia Jacalin Protein, Fluorescein labeled | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC9-317HCL | Recombinant Human WFDC9 293 Cell Lysate | +Inquiry |
CADM3-2556HCL | Recombinant Human CADM3 cell lysate | +Inquiry |
OVOL2-1264HCL | Recombinant Human OVOL2 cell lysate | +Inquiry |
RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
SIX3-1823HCL | Recombinant Human SIX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnp2c Products
Required fields are marked with *
My Review for All mnp2c Products
Required fields are marked with *
0
Inquiry Basket