Recombinant Lama glama IL2 protein, His-tagged
Cat.No. : | IL2-653L |
Product Overview : | Recombinant Lama glama IL2 protein(Q865X2)(21-154aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lama glama |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-154a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT |
◆ Recombinant Proteins | ||
IL2-5729C | Recombinant Chicken IL2 | +Inquiry |
IL2-196P | Active Recombinant Pig IL2 Protein (Ala21-Thr154), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il2-01M | Active Recombinant Mouse Il2 Protein, His-Tagged | +Inquiry |
IL2-0182H | Active Recombinant Human IL2 protein, Fc-tagged | +Inquiry |
Il2-4055M | Recombinant Mouse Il2 Protein (Ala21-Gln169), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *
0
Inquiry Basket