Recombinant Klebsiella pneumoniae KPHS_15810 Protein
Cat.No. : | KPHS_15810-166K |
Product Overview : | Recombinant Klebsiella pneumoniae KPHS_15810 Protein was expressed in E.coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella pneumoniae |
Source : | E.coli |
Description : | TolA colicin import membrane protein |
Form : | 50mM Tris-HCl, pH 8.0, 200mM NaCl. |
Molecular Mass : | ~32 kDa |
AA Sequence : | SSFDEHLDASAGGGGGSSIDAVMVDPGAVVNNYNRQQQQQASARRAAEQREKQAQQQAEELREKQAAEQERLKQLEQERLQAQEAAKEAKEQQKQAEEAAAKAAAAAKAKADAQAKEAQEAAAKAAAEAKAKADAQAKAAEQAAAKAAADAKKQAEAAAAKAAAEAKKQAEAEAAKAAAEAQKKAEAAAAKKAQQEAEKKAQQEAAKQAAAEKAAAEKAAEKAAAQKAAAEKAAAEKAAAAEKAAAAKAAAAEKAAADKAAKAAAAKAAAAKKAAAAKEADGVDNLLGDLSSGKNAPKTGGGAKGNNASAAG |
Purity : | >85% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Gene Name | KPHS_15810 TolA colicin import membrane protein [ Klebsiella pneumoniae subsp. pneumoniae HS11286 ] |
Official Symbol | KPHS_15810 |
Gene ID | 11846589 |
Protein Refseq | YP_005225881 |
UniProt ID | A0A0H3GU69 |
◆ Recombinant Proteins | ||
C14orf143-10389H | Recombinant Human C14orf143, His-tagged | +Inquiry |
IL1RAP-1638H | Recombinant Human Interleukin 1 Receptor Accessory Protein-Like 1 | +Inquiry |
FAIM3-277H | Recombinant Human FAIM3, Fc-tagged | +Inquiry |
WDR76-7832Z | Recombinant Zebrafish WDR76 | +Inquiry |
TOMT-17226M | Recombinant Mouse TOMT Protein | +Inquiry |
◆ Native Proteins | ||
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
Glycated Albumin-006B | Native Bovine Glycated Albumin Protein | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES2-320HCL | Recombinant Human HES2 lysate | +Inquiry |
GDI2-5964HCL | Recombinant Human GDI2 293 Cell Lysate | +Inquiry |
Eye-430S | Sheep Eye Lysate, Total Protein | +Inquiry |
PLEKHM1P-1021HCL | Recombinant Human PLEKHM1P cell lysate | +Inquiry |
HARS-770HCL | Recombinant Human HARS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KPHS_15810 Products
Required fields are marked with *
My Review for All KPHS_15810 Products
Required fields are marked with *
0
Inquiry Basket