Recombinant Influenza A virus (strain A/USA:Phila/1935 H1N1) M protein, His-tagged
Cat.No. : | M-2432I |
Product Overview : | Recombinant Influenza A virus (strain A/USA:Phila/1935 H1N1) M protein(A4GCM0)(1-97aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/USA:Phila/1935 H1N1) |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-97aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.1 kDa |
AA Sequence : | MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket