Recombinant Human ZWINT Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZWINT-4887H
Product Overview : ZWINT MS Standard C13 and N15-labeled recombinant protein (NP_127490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that is clearly involved in kinetochore function although an exact role is not known. It interacts with ZW10, another kinetochore protein, possibly regulating the association between ZW10 and kinetochores. The encoded protein localizes to prophase kinetochores before ZW10 does and it remains detectable on the kinetochore until late anaphase. It has a uniform distribution in the cytoplasm of interphase cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 31.2 kDa
AA Sequence : MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZWINT ZW10 interactor [ Homo sapiens (human) ]
Official Symbol ZWINT
Synonyms ZWINT; ZW10 interactor; KNTC2AP; zwint-1; ZW10-interacting protein 1; human ZW10 interacting protein-1; ZWINT1; HZwint-1; MGC117174;
Gene ID 11130
mRNA Refseq NM_032997
Protein Refseq NP_127490
MIM 609177
UniProt ID O95229

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZWINT Products

Required fields are marked with *

My Review for All ZWINT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon