Recombinant Human ZPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZPLD1-2782H
• Product Overview: ZPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_778226) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Glycoprotein which is a component of the gelatinous extracellular matrix in the cupulae of the vestibular organ.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 47.2 kDa
• AA Sequence: MMLRFSMCRGNDEGFAMEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLFSGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYGNATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVRENNGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZPLD1 zona pellucida-like domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: ZPLD1
• Synonyms: ZPLD1; zona pellucida-like domain containing 1; zona pellucida-like domain-containing protein 1; ZP domain-containing protein 1
• Gene ID: 131368
• mRNA Refseq: NM_175056
• Protein Refseq: NP_778226
• MIM: 615915
• UniProt ID: Q8TCW7