Recombinant Human ZNF706 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZNF706-930H
• Product Overview: ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ZNF706 (Zinc Finger Protein 706) is a Protein Coding gene. Among its related pathways are Gene Expression.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 8.5 kDa
• AA Sequence: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZNF706 zinc finger protein 706 [ Homo sapiens (human) ]
• Official Symbol: ZNF706
• Synonyms: ZNF706; zinc finger protein 706; HSPC038; PNAS-106; PNAS-113
• Gene ID: 51123
• mRNA Refseq: NM_001042510
• Protein Refseq: NP_001035975
• UniProt ID: Q9Y5V0