Recombinant Human ZNF706 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZNF706-930H
Product Overview : ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ZNF706 (Zinc Finger Protein 706) is a Protein Coding gene. Among its related pathways are Gene Expression.
Molecular Mass : 8.5 kDa
AA Sequence : MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZNF706 zinc finger protein 706 [ Homo sapiens (human) ]
Official Symbol ZNF706
Synonyms ZNF706; zinc finger protein 706; HSPC038; PNAS-106; PNAS-113;
Gene ID 51123
mRNA Refseq NM_001042510
Protein Refseq NP_001035975
UniProt ID Q9Y5V0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZNF706 Products

Required fields are marked with *

My Review for All ZNF706 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon