Recombinant Human ZKSCAN7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZKSCAN7-922H
• Product Overview: ZNF167 MS Standard C13 and N15-labeled recombinant protein (NP_079445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: May be involved in transcriptional regulation.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 30.6 kDa
• AA Sequence: MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQLCYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPESGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMMPENHHSMASLGWSTMATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZKSCAN7 zinc finger with KRAB and SCAN domains 7 [ Homo sapiens (human) ]
• Official Symbol: ZKSCAN7
• Synonyms: ZKSCAN7; zinc finger with KRAB and SCAN domains 7; ZFP; ZNF64; ZNF167; ZNF448; ZSCAN39; zinc finger protein with KRAB and SCAN domains 7; zinc finger protein 167; zinc finger protein 448; zinc finger protein 64
• Gene ID: 55888
• mRNA Refseq: NM_025169
• Protein Refseq: NP_079445
• UniProt ID: Q9P0L1