Recombinant Human ZBTB17 protein(651-750 aa), C-His-tagged

• Cat.No.: ZBTB17-2844H
• Product Overview: Recombinant Human ZBTB17 protein(Q13105)(651-750 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 651-750 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: GSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ZBTB17 zinc finger and BTB domain containing 17 [ Homo sapiens ]
• Official Symbol: ZBTB17
• Synonyms: MIZ-1; ZNF60; ZNF151; pHZ-67
• Gene ID: 7709
• mRNA Refseq: NM_003443.2
• Protein Refseq: NP_003434.2
• MIM: 604084
• UniProt ID: Q13105