Recombinant Human YES1, His-tagged
Cat.No. : | YES1-31564TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 261-543 of Human Yes1 with an N terminal His tag. Predicted MWt: 33 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 261-543 a.a. |
Description : | This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 132 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAV VSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDM AAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFG LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSD VWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMP CPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYF TATEPQYQPGENL |
Sequence Similarities : | Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.Contains 1 protein kinase domain.Contains 1 SH2 domain.Contains 1 SH3 domain. |
Gene Name | YES1 v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 [ Homo sapiens ] |
Official Symbol | YES1 |
Synonyms | YES1; v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1; tyrosine-protein kinase Yes; c yes; HsT441; Yes; |
Gene ID | 7525 |
mRNA Refseq | NM_005433 |
Protein Refseq | NP_005424 |
MIM | 164880 |
Uniprot ID | P07947 |
Chromosome Location | 18p11.31-p11.21 |
Pathway | Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha-synuclein signaling, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; |
Function | ATP binding; ion channel binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein tyrosine kinase activity; |
◆ Recombinant Proteins | ||
YES1-5236R | Recombinant Rhesus monkey YES1 Protein, His-tagged | +Inquiry |
YES1-2374H | Recombinant Human YES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YES1-0737H | Recombinant Human YES1 Protein (G2-L543), Tag Free | +Inquiry |
YES1-5049R | Recombinant Rhesus Macaque YES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YES1-18657M | Recombinant Mouse YES1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
YES1-620HCL | Recombinant Human YES1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YES1 Products
Required fields are marked with *
My Review for All YES1 Products
Required fields are marked with *
0
Inquiry Basket