Recombinant Human YES1, His-tagged

Cat.No. : YES1-31564TH
Product Overview : Recombinant fragment, corresponding to amino acids 261-543 of Human Yes1 with an N terminal His tag. Predicted MWt: 33 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 261-543 a.a.
Description : This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.
Conjugation : HIS
Form : Lyophilised:reconstitution with 132 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAV VSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDM AAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFG LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSD VWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMP CPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYF TATEPQYQPGENL
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.Contains 1 protein kinase domain.Contains 1 SH2 domain.Contains 1 SH3 domain.
Gene Name YES1 v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 [ Homo sapiens ]
Official Symbol YES1
Synonyms YES1; v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1; tyrosine-protein kinase Yes; c yes; HsT441; Yes;
Gene ID 7525
mRNA Refseq NM_005433
Protein Refseq NP_005424
MIM 164880
Uniprot ID P07947
Chromosome Location 18p11.31-p11.21
Pathway Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha-synuclein signaling, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem;
Function ATP binding; ion channel binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein tyrosine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All YES1 Products

Required fields are marked with *

My Review for All YES1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon