Recombinant Human YEATS4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: YEATS4-1011H
• Product Overview: YEATS4 MS Standard C13 and N15-labeled recombinant protein (NP_006521) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 26.5 kDa
• AA Sequence: MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: YEATS4 YEATS domain containing 4 [ Homo sapiens (human) ]
• Official Symbol: YEATS4
• Synonyms: YEATS4; YEATS domain containing 4; YEATS domain-containing protein 4; GAS41; NuBI 1; YAF9; nuBI1; NuMA binding protein 1; nuMA-binding protein 1; glioma-amplified sequence 41; glioma-amplified sequence-41; NUBI-1; 4930573H17Rik; B230215M10Rik
• Gene ID: 8089
• mRNA Refseq: NM_006530
• Protein Refseq: NP_006521
• MIM: 602116
• UniProt ID: O95619