Recombinant Human YARS protein, T7/His-tagged

Cat.No. : YARS-207H
Product Overview : Recombinant human YARS N-terminal fragment (Mini-TyrRA) cDNA (2 – 364 aa, derived from BC016689) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-364 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGK PHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTD YQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEK YLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLK SEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQ KPMAKGPAKNSEPEEVI
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro Mini-YARS protein mediated interleukine-8 like activities regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for Mini-YARS protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name YARS tyrosyl-tRNA synthetase [ Homo sapiens ]
Official Symbol YARS
Synonyms YARS; tyrosyl-tRNA synthetase; tyrosine--tRNA ligase, cytoplasmic; tyrosine tRNA ligase 1; cytoplasmic; tyrRS; YRS; YTS; tyrosyl--tRNA ligase; tyrosine tRNA ligase 1, cytoplasmic; tyrosyl-tRNA synthetase, cytoplasmic; TYRRS; CMTDIC;
Gene ID 8565
mRNA Refseq NM_003680
Protein Refseq NP_003671
MIM 603623
UniProt ID P54577
Chromosome Location 1p35.1
Pathway Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem;
Function ATP binding; interleukin-8 receptor binding; ligase activity; nucleotide binding; signal transducer activity; tRNA binding; tyrosine-tRNA ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All YARS Products

Required fields are marked with *

My Review for All YARS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon