Recombinant Human YAP1 protein, His-B2M-tagged

• Cat.No.: YAP1-3775H
• Product Overview: Recombinant Human YAP1 protein(P46937)(1-504aa), fused to N-terminal His-B2M tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 1-504aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 68.5 kDa
• AA Sequence: MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: YAP1 Yes-associated protein 1 [ Homo sapiens ]
• Official Symbol: YAP1
• Synonyms: YAP1; Yes-associated protein 1; Yes associated protein 1, 65kDa; yorkie homolog; YAP65; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; 65 kDa Yes-associated protein; YAP; YKI; YAP2
• Gene ID: 10413
• mRNA Refseq: NM_001130145
• Protein Refseq: NP_001123617
• MIM: 606608
• UniProt ID: P46937