Recombinant Human XDH Protein, Full Length, C-FLAG tagged

Cat.No. : ACBD7-6169HFL
Product Overview : Recombinant protein of human acyl-Coenzyme A binding domain containing 7 (ACBD7) with C-FLAG tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Protein Length : Full Length
Description : Binds medium- and long-chain acyl-CoA esters.
Molecular Mass : 9.6 kDa
AA Sequence : MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >0.05 μg/μL as determined by microplate BCA method
Storage Buffer : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Gene Name ACBD7 acyl-CoA binding domain containing 7 [ Homo sapiens (human) ]
Official Symbol ACBD7
Synonyms ACBD7; acyl-CoA binding domain containing 7; acyl Coenzyme A binding domain containing 7; acyl-CoA-binding domain-containing protein 7; bA455B2.2; FLJ38219; acyl-Coenzyme A binding domain containing 7; FLJ52263; MGC33893
Gene ID 414149
mRNA Refseq NM_001039844
Protein Refseq NP_001034933
UniProt ID Q8N6N7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACBD7 Products

Required fields are marked with *

My Review for All ACBD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon