Recombinant Human XDH Protein, Full Length, C-FLAG tagged

• Cat.No.: ACBD7-6169HFL
• Product Overview: Recombinant protein of human acyl-Coenzyme A binding domain containing 7 (ACBD7) with C-FLAG tag was expressed in HEK293T.

Specification

• Description: Binds medium- and long-chain acyl-CoA esters.
• Source: HEK293T
• Species: Human
• Tag: Flag
• Protein length: Full Length
• Molecular Mass: 9.6 kDa
• AA Sequence: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >0.05 μg/μL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol

Gene Information

• Gene Name: ACBD7 acyl-CoA binding domain containing 7 [ Homo sapiens (human) ]
• Official Symbol: ACBD7
• Synonyms: ACBD7; acyl-CoA binding domain containing 7; acyl Coenzyme A binding domain containing 7; acyl-CoA-binding domain-containing protein 7; bA455B2.2; FLJ38219; acyl-Coenzyme A binding domain containing 7; FLJ52263; MGC33893
• Gene ID: 414149
• mRNA Refseq: NM_001039844
• Protein Refseq: NP_001034933
• UniProt ID: Q8N6N7