Recombinant Human XAB2 protein, GST-tagged

• Cat.No.: XAB2-23H
• Product Overview: Recombinant Human GST(530 - 855 aa ) fused with GST tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 530-855 a.a.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
• AA Sequence: EHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
• Storage: Short-term storage: Store at 2-8 centigrade for two weeks.
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: XAB2 XPA binding protein 2 [ Homo sapiens ]
• Official Symbol: XAB2
• Synonyms: XAB2; XPA binding protein 2; pre-mRNA-splicing factor SYF1; HCNP; HCRN; NTC90; SYF1; SYF1 homolog; RNA splicing factor (S. cerevisiae); XPA-binding protein 2; crn-related protein kim1; SYF1 homolog, RNA splicing factor; DKFZp762C1015
• Gene ID: 56949
• mRNA Refseq: NM_020196
• Protein Refseq: NP_064581
• MIM: 610850
• UniProt ID: Q9HCS7