Recombinant Human WT1 Protein, His-tagged

• Cat.No.: WT1-001H
• Product Overview: Recombinant Human WT1 Protein, His-tagged, expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 127-249 aa
• Tag: His
• Molecular Mass: 15 kDa
• AA Sequence: MFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose

Gene Information

• Gene Name: WT1 WT1 transcription factor [ Homo sapiens (human) ]
• Official Symbol: WT1
• Synonyms: GUD; AWT1; WAGR; WT-1; WT33; NPHS4; WIT-2; WT1
• Gene ID: 7490
• MIM: 607102
• UniProt ID: P19544