Recombinant Human WT1-AS Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: WT1-AS-2098H
• Product Overview: WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 9.9 kDa
• AA Sequence: MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: WT1-AS WT1 antisense RNA [ Homo sapiens (human) ]
• Official Symbol: WT1-AS
• Synonyms: WT1-AS; WT1 antisense RNA; WIT1; WIT-1; WT1AS; WT1-AS1; MGC120207; MGC120208; MGC120209
• Gene ID: 51352
• mRNA Refseq: NM_015855
• Protein Refseq: NP_056939
• MIM: 607899
• UniProt ID: Q06250