Recombinant Human WSB1, His-tagged

Cat.No. : WSB1-31528TH
Product Overview : Recombinant fragment, corresponding to amino acids 26-242 of Human WSB1 with N terminal His tag; MWt 25kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 26-242 a.a.
Description : This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQ CLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHI IDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQL LLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFA PDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS CAFSPDSSMLCSVGASKAVFLWN
Gene Name WSB1 WD repeat and SOCS box containing 1 [ Homo sapiens ]
Official Symbol WSB1
Synonyms WSB1; WD repeat and SOCS box containing 1; WD repeat and SOCS box-containing protein 1; DKFZp564A122; DKFZp564B0482; SWIP1;
Gene ID 26118
mRNA Refseq NM_015626
Protein Refseq NP_056441
MIM 610091
Uniprot ID Q9Y6I7
Chromosome Location 17q11.2
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WSB1 Products

Required fields are marked with *

My Review for All WSB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon