Recombinant Human WNT1, StrepII-tagged
Cat.No. : | WNT1-204H |
Product Overview : | Purified, full-length human recombinant WNT1 protein (amino acids 28-370, 343 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.3 kDa. (Accession NP_005421.1; UniProt P04628) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 28-370, 343 a.a. |
Description : | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family. It is very conserved in evolution, and the protein is 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | ANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRW NCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFG RLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDG ASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCEL LCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4??C after reconstitution. Avoid freeze/thaw cycles. - See more at: http://www.genemed.com/90001#sthash.FsM1acyN.dpuf |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT1 wingless-type MMTV integration site family, member 1 [ Homo sapiens ] |
Official Symbol | WNT1 |
Synonyms | WNT1; wingless-type MMTV integration site family, member 1; INT1; proto-oncogene Wnt-1; proto-oncogene Int-1 homolog; wingless-type MMTV integration site family, member 1 (oncogene INT1); |
Gene ID | 7471 |
mRNA Refseq | NM_005430 |
Protein Refseq | NP_005421 |
MIM | 164820 |
UniProt ID | P04628 |
Chromosome Location | 12q13 |
Pathway | Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | cytokine activity; frizzled binding; frizzled-2 binding; protein binding; protein domain specific binding; receptor agonist activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
WNT1-18563M | Recombinant Mouse WNT1 Protein | +Inquiry |
WNT1-581H | Recombinant Human WNT1 Protein, His&GST-tagged | +Inquiry |
WNT1-10190M | Recombinant Mouse WNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT1-7866H | Recombinant Human WNT1 protein, His-tagged | +Inquiry |
Wnt1-5875M | Recombinant Mouse Wnt1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT1-304HCL | Recombinant Human WNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT1 Products
Required fields are marked with *
My Review for All WNT1 Products
Required fields are marked with *
0
Inquiry Basket