Recombinant Human WIF1 Protein, His-tagged
Cat.No. : | WIF1-163H |
Product Overview : | Recombinant Human WIF1 fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers. |
Form : | Lyophilized from a 0.2 µM filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.5% CHAPS, pH 4.0 |
Molecular Mass : | 39.47kD |
AA Sequence : | GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIWVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | WIF1 WNT inhibitory factor 1 [ Homo sapiens ] |
Official Symbol | WIF1 |
Synonyms | WIF1; WNT inhibitory factor 1; wnt inhibitory factor 1; WIF-1; |
Gene ID | 11197 |
mRNA Refseq | NM_007191 |
Protein Refseq | NP_009122 |
MIM | 605186 |
UniProt ID | Q9Y5W5 |
◆ Recombinant Proteins | ||
WIF1-2698H | Recombinant Human WIF1 protein, His-tagged | +Inquiry |
Wif1-372M | Recombinant Mouse Wif1 Protein, His-tagged | +Inquiry |
WIF1-578H | Recombinant Human WIF1 Protein, His-tagged | +Inquiry |
WIF1-5216R | Recombinant Rhesus monkey WIF1 Protein, His-tagged | +Inquiry |
WIF1-359H | Recombinant Human WIF1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WIF1-1525MCL | Recombinant Mouse WIF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WIF1 Products
Required fields are marked with *
My Review for All WIF1 Products
Required fields are marked with *
0
Inquiry Basket