Recombinant Human WIF1 Protein, His-tagged

• Cat.No.: WIF1-163H
• Product Overview: Recombinant Human WIF1 fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers.
• Form: Lyophilized from a 0.2 µM filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.5% CHAPS, pH 4.0
• Molecular Mass: 39.47kD
• AA Sequence: GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIWVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: WIF1 WNT inhibitory factor 1 [ Homo sapiens ]
• Official Symbol: WIF1
• Synonyms: WIF1; WNT inhibitory factor 1; wnt inhibitory factor 1; WIF-1
• Gene ID: 11197
• mRNA Refseq: NM_007191
• Protein Refseq: NP_009122
• MIM: 605186
• UniProt ID: Q9Y5W5