Recombinant Human WDR83 Protein, GST-tagged

• Cat.No.: WDR83-5286H
• Product Overview: Human MGC4238 partial ORF ( NP_115708, 171 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
• Molecular Mass: 35.86 kDa
• AA Sequence: VDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: WDR83 WD repeat domain 83 [ Homo sapiens (human) ]
• Official Symbol: WDR83
• Synonyms: WDR83; WD repeat domain 83; MORG1; WD repeat domain-containing protein 83; MAPK organizer 1; mitogen-activated protein kinase organizer 1
• Gene ID: 84292
• mRNA Refseq: NM_001099737
• Protein Refseq: NP_001093207
• MIM: 616850
• UniProt ID: Q9BRX9