Recombinant Human VPS53 protein, His-tagged

• Cat.No.: VPS53-2745H
• Product Overview: Recombinant Human VPS53 protein(1-128 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-128 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: VPS53 vacuolar protein sorting 53 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: VPS53
• Synonyms: VPS53; vacuolar protein sorting 53 homolog (S. cerevisiae); vacuolar protein sorting 53 (yeast); vacuolar protein sorting-associated protein 53 homolog; FLJ10979; HCCS1; hVps53L; pp13624; FLJ41112; FLJ61757; MGC39512
• Gene ID: 55275
• mRNA Refseq: NM_001128159
• Protein Refseq: NP_001121631
• UniProt ID: Q5VIR6