Recombinant Human VPS28 protein, T7-tagged
Cat.No. : | VPS28-184H |
Product Overview : | Recombinant human VPS28 (221aa, Isoform_1) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 221 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSTSMFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAY IKDCVSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIAD VVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLF DLESAYNAFNRFLHA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro endosomal sorting pathway regulation study with intracellular delivery methods.2. As soluble /native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping viral particle budding pathway regulation with protein–protein interaction assay.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | VPS28 vacuolar protein sorting 28 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VPS28 |
Synonyms | VPS28; vacuolar protein sorting 28 homolog (S. cerevisiae); vacuolar protein sorting 28 (yeast); vacuolar protein sorting-associated protein 28 homolog; H-Vps28; ESCRT-I complex subunit VPS28; yeast class E protein Vps28p homolog; MGC60323; |
Gene ID | 51160 |
mRNA Refseq | NM_016208 |
Protein Refseq | NP_057292 |
MIM | 611952 |
UniProt ID | Q9UK41 |
Chromosome Location | 8q24.3 |
Pathway | Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; ESCRT-I complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; HIV Infection, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
VPS28-18368M | Recombinant Mouse VPS28 Protein | +Inquiry |
VPS28-4066H | Recombinant Human VPS28 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VPS28-7520H | Recombinant Human VPS28 protein, His-tagged | +Inquiry |
VPS28-276H | Recombinant Human VPS28 Protein, GST-His-tagged | +Inquiry |
Vps28-6935M | Recombinant Mouse Vps28 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS28-393HCL | Recombinant Human VPS28 293 Cell Lysate | +Inquiry |
VPS28-392HCL | Recombinant Human VPS28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VPS28 Products
Required fields are marked with *
My Review for All VPS28 Products
Required fields are marked with *
0
Inquiry Basket