Recombinant Human VMA21 protein, His-tagged

• Cat.No.: VMA21-3627H
• Product Overview: Recombinant Human VMA21 protein(1-101 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-101 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: VMA21
• Synonyms: VMA21; VMA21 vacuolar H+-ATPase homolog (S. cerevisiae); MEAX, myopathy with excessive autophagy; vacuolar ATPase assembly integral membrane protein VMA21; XMEA; myopathy with excessive autophagy protein; MEAX; MGC125514; MGC125516; MGC131652
• Gene ID: 203547
• mRNA Refseq: NM_001017980
• Protein Refseq: NP_001017980
• UniProt ID: Q3ZAQ7