Recombinant Human VKORC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: VKORC1-4806H
• Product Overview: VKORC1 MS Standard C13 and N15-labeled recombinant protein (NP_996560) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 9.7 kDa
• AA Sequence: MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGVSRWFCLPGLDPVLRALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: VKORC1 vitamin K epoxide reductase complex subunit 1 [ Homo sapiens (human) ]
• Official Symbol: VKORC1
• Synonyms: VKORC1; vitamin K epoxide reductase complex, subunit 1; vitamin K dependent clotting factors deficiency 2, VKCFD2; vitamin K epoxide reductase complex subunit 1; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K dependent clotting factors deficiency 2; vitamin K1 epoxide reductase (warfarin-sensitive); VKOR; MST134; MST576; VKCFD2; EDTP308; IMAGE3455200; MGC2694; FLJ00289
• Gene ID: 79001
• mRNA Refseq: NM_206824
• Protein Refseq: NP_996560
• MIM: 608547
• UniProt ID: Q9BQB6