Recombinant Human vesicle-associated membrane protein 7 Protein, His tagged

• Cat.No.: VAMP7-13H
• Product Overview: Recombinant human VAMP7 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-188aa
• Description: This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants.
• Tag: N-His
• Form: Liquid
• Molecular Mass: 23.8 kDa
• AA Sequence: MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLK
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• References: 1. Logan MR, et al. (2006). Allergy. Jun 61(6):777-84.
  2. Marcet-Palacios M, et al. (2008) Biochem Biophys Res Commun. 15 366(3):617-23.

Gene Information

• Gene Name: VAMP7 vesicle-associated membrane protein 7 [ Homo sapiens (human) ]
• Official Symbol: VAMP7
• Synonyms: VAMP7; vesicle-associated membrane protein 7; SYBL1, synaptobrevin like 1; TI VAMP; VAMP 7; synaptobrevin-like 1; tetanus-insensitive VAMP; synaptobrevin-like protein 1; tetanus neurotoxin-insensitive VAMP; SYBL1; TIVAMP; VAMP-7; TI-VAMP; FLJ53045; FLJ53762; FLJ54296
• Gene ID: 6845
• mRNA Refseq: NM_005638
• Protein Refseq: NP_005629
• MIM: 300053
• UniProt ID: P51809