Recombinant Human VEGFB, StrepII-tagged
Cat.No. : | VEGFB-280H |
Product Overview : | Purified, full-length human recombinant VEGFB (VRF) protein (amino acids 22-207, 186 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 43.2 kDa. (Accession NP_001230662; UniProt P49765) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 22-207, 186 a.a. |
Description : | VEGFB is a growth factor for endothelial cells and regulates the formation of blood vessels. This protein is a ligand for VEGFR-1 and NRP-1. VEGFB is a disulfide-linked homodimer and can also form a heterodimer with VEGF. VEGFB is expressed in all tissues except liver, with the highest levels found in the heart, skeletal muscle, and pancreas. This protein belongs to the PDGF/VEGF growth factor family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQ VRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPA PGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >80% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
Gene Name | VEGFB vascular endothelial growth factor B [ Homo sapiens ] |
Official Symbol | VEGFB |
Synonyms | VEGFB; vascular endothelial growth factor B; VRF; VEGFL; VEGF-related factor; |
Gene ID | 7423 |
mRNA Refseq | NM_001243733 |
Protein Refseq | NP_001230662 |
MIM | 601398 |
UniProt ID | P49765 |
Chromosome Location | 11q13 |
Pathway | Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | chemoattractant activity; growth factor activity; heparin binding; protein binding; protein heterodimerization activity; protein homodimerization activity; vascular endothelial growth factor receptor 1 binding; |
◆ Recombinant Proteins | ||
VEGFB-1554H | Recombinant Human VEGFB Protein (22-207 aa), His-tagged | +Inquiry |
VEGFB-6558H | Recombinant Human VEGFB Protein (Pro22-Ala207), N-His tagged | +Inquiry |
VEGFB-596C | Recombinant Cattle VEGFB protein, His & T7-tagged | +Inquiry |
VEGFB-18005M | Recombinant Mouse VEGFB Protein | +Inquiry |
VEGFB-0506H | Recombinant Human VEGFB Protein (M1-A207), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFB-416HCL | Recombinant Human VEGFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VEGFB Products
Required fields are marked with *
My Review for All VEGFB Products
Required fields are marked with *
0
Inquiry Basket