Recombinant Human VEGFB, StrepII-tagged

• Cat.No.: VEGFB-280H
• Product Overview: Purified, full-length human recombinant VEGFB (VRF) protein (amino acids 22-207, 186 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 43.2 kDa. (Accession NP_001230662; UniProt P49765)

Specification

• Species: Human
• Source: Human Cells
• Tag: StrepII
• ProteinLength: 22-207, 186 a.a.
• Description: VEGFB is a growth factor for endothelial cells and regulates the formation of blood vessels. This protein is a ligand for VEGFR-1 and NRP-1. VEGFB is a disulfide-linked homodimer and can also form a heterodimer with VEGF. VEGFB is expressed in all tissues except liver, with the highest levels found in the heart, skeletal muscle, and pancreas. This protein belongs to the PDGF/VEGF growth factor family.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQ VRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPA PGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >80% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml

Gene Information

• Gene Name: VEGFB vascular endothelial growth factor B [ Homo sapiens ]
• Official Symbol: VEGFB
• Synonyms: VEGFB; vascular endothelial growth factor B; VRF; VEGFL; VEGF-related factor
• Gene ID: 7423
• mRNA Refseq: NM_001243733
• Protein Refseq: NP_001230662
• MIM: 601398
• UniProt ID: P49765
• Chromosome Location: 11q13
• Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem
• Function: chemoattractant activity; growth factor activity; heparin binding; protein binding; protein heterodimerization activity; protein homodimerization activity; vascular endothelial growth factor receptor 1 binding