Recombinant Human VEGFB, StrepII-tagged

Cat.No. : VEGFB-280H
Product Overview : Purified, full-length human recombinant VEGFB (VRF) protein (amino acids 22-207, 186 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 43.2 kDa. (Accession NP_001230662; UniProt P49765)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 22-207, 186 a.a.
Description : VEGFB is a growth factor for endothelial cells and regulates the formation of blood vessels. This protein is a ligand for VEGFR-1 and NRP-1. VEGFB is a disulfide-linked homodimer and can also form a heterodimer with VEGF. VEGFB is expressed in all tissues except liver, with the highest levels found in the heart, skeletal muscle, and pancreas. This protein belongs to the PDGF/VEGF growth factor family.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
AA Sequence : PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQ VRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPA PGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA
Endotoxin : <0.1 eu per μg protein by lal
Purity : >80% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name VEGFB vascular endothelial growth factor B [ Homo sapiens ]
Official Symbol VEGFB
Synonyms VEGFB; vascular endothelial growth factor B; VRF; VEGFL; VEGF-related factor;
Gene ID 7423
mRNA Refseq NM_001243733
Protein Refseq NP_001230662
MIM 601398
UniProt ID P49765
Chromosome Location 11q13
Pathway Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function chemoattractant activity; growth factor activity; heparin binding; protein binding; protein heterodimerization activity; protein homodimerization activity; vascular endothelial growth factor receptor 1 binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VEGFB Products

Required fields are marked with *

My Review for All VEGFB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon