Recombinant Human VEGFA, GST-tagged

• Cat.No.: VEGFA-102H
• Product Overview: Human VEGFA full-length ORF ( ENSP00000361134, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.
• Molecular Mass: 43.6 kDa
• AA Sequence: MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKP SCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens(human) ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; VPF; VEGF; MVCD1; vascular endothelial growth factor A; vascular permeability factor
• Gene ID: 7422
• mRNA Refseq: NM_001171626
• Protein Refseq: NP_001165097
• MIM: 192240
• UniProt ID: P15692
• Chromosome Location: 6p12
• Pathway: Angiogenesis; Bladder cancer; Cellular response to hypoxia
• Function: chemoattractant activity; cytokine activity; extracellular matrix binding