Recombinant Human UXT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UXT-2890H
• Product Overview: UXT MS Standard C13 and N15-labeled recombinant protein (NP_004173) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 18.2 kDa
• AA Sequence: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UXT ubiquitously expressed prefoldin like chaperone [ Homo sapiens (human) ]
• Official Symbol: UXT
• Synonyms: UXT; ubiquitously expressed prefoldin like chaperone; STAP1; ART-27; protein UXT; SKP2-associated alpha PFD 1; androgen receptor trapped clone 27 protein; ubiquitously expressed transcript protein
• Gene ID: 8409
• mRNA Refseq: NM_004182
• Protein Refseq: NP_004173
• MIM: 300234
• UniProt ID: Q9UBK9