Recombinant Human UXT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UXT-2890H |
Product Overview : | UXT MS Standard C13 and N15-labeled recombinant protein (NP_004173) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UXT ubiquitously expressed prefoldin like chaperone [ Homo sapiens (human) ] |
Official Symbol | UXT |
Synonyms | UXT; ubiquitously expressed prefoldin like chaperone; STAP1; ART-27; protein UXT; SKP2-associated alpha PFD 1; androgen receptor trapped clone 27 protein; ubiquitously expressed transcript protein |
Gene ID | 8409 |
mRNA Refseq | NM_004182 |
Protein Refseq | NP_004173 |
MIM | 300234 |
UniProt ID | Q9UBK9 |
◆ Recombinant Proteins | ||
UXT-3639H | Recombinant Human UXT, GST-tagged | +Inquiry |
Uxt-6889M | Recombinant Mouse Uxt Protein, Myc/DDK-tagged | +Inquiry |
UXT-1380Z | Recombinant Zebrafish UXT | +Inquiry |
UXT-7926H | Recombinant Human UXT protein, His & T7-tagged | +Inquiry |
Uxt-7927M | Recombinant Mouse Uxt protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UXT-442HCL | Recombinant Human UXT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UXT Products
Required fields are marked with *
My Review for All UXT Products
Required fields are marked with *
0
Inquiry Basket