Recombinant Human USPL1 protein, GST-tagged

• Cat.No.: USPL1-301333H
• Product Overview: Recombinant Human USPL1 (31-220 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Leu31-Ser220
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: LGKNFDSAKVPSDEYCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNPIRTADSLERNEILEADTVDMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKCTS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: USPL1 ubiquitin specific peptidase like 1 [ Homo sapiens ]
• Official Symbol: USPL1
• Synonyms: USPL1; ubiquitin specific peptidase like 1; C13orf22, chromosome 13 open reading frame 22; ubiquitin-specific peptidase-like protein 1; bA121O19.1; D13S106E; highly charged protein; C13orf22; FLJ32952; RP11-121O19.1; DKFZp781K2286
• Gene ID: 10208
• mRNA Refseq: NM_005800
• Protein Refseq: NP_005791
• UniProt ID: Q5W0Q7