Recombinant Human USP7, His-tagged

Cat.No. : USP7-29182TH
Product Overview : Recombinant fragment, corresponding to amino acids 907-1102 of Human HAUSP / USP7 with N terminal His tag; 196 amino acids, 29kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 907-1102 a.a.
Description : Ubiquitin-specific-processing protease 7 (USP7) also known as ubiquitin carboxyl-terminal hydrolase 7 or herpesvirus-associated ubiquitin-specific protease (HAUSP) is an enzyme that in humans is encoded by the USP7 gene.
Conjugation : HIS
Tissue specificity : Widely expressed. Overexpressed in prostate cancer.
Form : Lyophilised:Reconstitute with 146 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVS YKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDK ENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMK RIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKD FEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKI HN
Sequence Similarities : Belongs to the peptidase C19 family.Contains 1 MATH domain.
Gene Name USP7 ubiquitin specific peptidase 7 (herpes virus-associated) [ Homo sapiens ]
Official Symbol USP7
Synonyms USP7; ubiquitin specific peptidase 7 (herpes virus-associated); HAUSP, ubiquitin specific protease 7 (herpes virus associated); ubiquitin carboxyl-terminal hydrolase 7;
Gene ID 7874
mRNA Refseq NM_003470
Protein Refseq NP_003461
MIM 602519
Uniprot ID Q93009
Chromosome Location 16p13.3
Pathway FoxO family signaling, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; p53 pathway, organism-specific biosystem;
Function cysteine-type endopeptidase activity; p53 binding; peptidase activity; protein C-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All USP7 Products

Required fields are marked with *

My Review for All USP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon