Recombinant Human USP15 protein, GST-tagged

• Cat.No.: USP15-301633H
• Product Overview: Recombinant Human USP15 (1-235 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Cys235
• AA Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: USP15 ubiquitin specific peptidase 15 [ Homo sapiens ]
• Official Symbol: USP15
• Synonyms: USP15; ubiquitin specific peptidase 15; ubiquitin specific protease 15; ubiquitin carboxyl-terminal hydrolase 15; KIAA0529; UNPH4; ubiquitin thioesterase 15; deubiquitinating enzyme 15; ubiquitin thiolesterase 15; ubiquitin-specific-processing protease 15; UNPH-2; FLJ55073; MGC74854; MGC131982; MGC149838
• Gene ID: 9958
• mRNA Refseq: NM_001252078
• Protein Refseq: NP_001239007
• MIM: 604731
• UniProt ID: Q9Y4E8