Recombinant Human UNC50 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UNC50-988H
• Product Overview: UNC50 MS Standard C13 and N15-labeled recombinant protein (NP_054763) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: UNC50 (Unc-50 Inner Nuclear Membrane RNA Binding Protein) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include RNA binding.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 30.4 kDa
• AA Sequence: MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UNC50 unc-50 inner nuclear membrane RNA binding protein [ Homo sapiens (human) ]
• Official Symbol: UNC50
• Synonyms: UNC50; unc-50 homolog (C. elegans); protein unc-50 homolog; GMH1; UNCL; URP; hGMH1; PDLs22; unc-50 related; protein GMH1 homolog; uncoordinated-like protein; periodontal ligament-specific protein 22; geal-6 membrane-associated high-copy suppressor 1; HSD23; DKFZp564G0222
• Gene ID: 25972
• mRNA Refseq: NM_014044
• Protein Refseq: NP_054763
• MIM: 617826
• UniProt ID: Q53HI1