Recombinant Human UGT1A9, GST-tagged

Cat.No. : UGT1A9-12H
Product Overview : Recombinant Human UGT1A9(1 a.a. - 530 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 86.3 kDa
AA Sequence : MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVK TYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPF DNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFK NALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGV YESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVE PLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAH KSKTH
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UGT1A9 UDP glucuronosyltransferase 1 family, polypeptide A9 [ Homo sapiens (human) ]
Official Symbol UGT1A9
Synonyms UGT1A9; UDP glucuronosyltransferase 1 family, polypeptide A9; LUGP4; UDPGT; UGT1I; HLUGP4; UGT-1I; UGT1-9; UGT1.9; UGT1AI; UGT1-09; UDPGT 1-9; UDP-glucuronosyltransferase 1-9; UDP glycosyltransferase 1 family, polypeptide A9; UDP-glucuronosyltransferase 1-I; UDP-glucuronosyltransferase 1A9; NP_066307.1; EC 2.4.1.17
Gene ID 54600
mRNA Refseq NM_021027
Protein Refseq NP_066307
MIM 606434
UniProt ID O60656
Chromosome Location 2q37
Pathway Arylamine metabolism; Ascorbate and aldarate metabolism; Chemical carcinogenesis; Defective AHCY causes Hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD)
Function enzyme binding; enzyme inhibitor activity; NOT glucuronosyltransferase activity; glucuronosyltransferase activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UGT1A9 Products

Required fields are marked with *

My Review for All UGT1A9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon