Recombinant Human UGCG protein, GST-tagged

• Cat.No.: UGCG-3581H
• Product Overview: Recombinant Human UGCG(1 a.a. - 394 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-394 a.a.
• Description: Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 71.3 kDa
• AA Sequence: MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFE LDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLIWICDSGIRVI PDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGG LIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMTIYIFLSALWDPTISW RTGRYRLRCGGTAEEILDV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: UGCG UDP-glucose ceramide glucosyltransferase [ Homo sapiens ]
• Official Symbol: UGCG
• Synonyms: UGCG; UDP-glucose ceramide glucosyltransferase; ceramide glucosyltransferase; GCS; glucosylceramide synthase; GLCT-1; UDP-glucose:N-acylsphingosine D-glucosyltransferase; GLCT1
• Gene ID: 7357
• mRNA Refseq: NM_003358
• Protein Refseq: NP_003349
• MIM: 602874
• UniProt ID: Q16739
• Chromosome Location: 9q31
• Pathway: Glycosphingolipid metabolism, organism-specific biosystem; IL2 signaling events mediated by PI3K, organism-specific biosystem; Lactosylceramide biosynthesis, organism-specific biosystem; Lactosylceramide biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem
• Function: ceramide glucosyltransferase activity; transferase activity, transferring glycosyl groups