Recombinant Human UCP1 protein, GST-tagged
Cat.No. : | UCP1-46H |
Product Overview : | Recombinant Human UCP1(232 a.a. - 267 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 232-267 a.a. |
Description : | Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 29.7 kDa |
AA Sequence : | PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | UCP1 uncoupling protein 1 (mitochondrial, proton carrier) [ Homo sapiens ] |
Official Symbol | UCP1 |
Synonyms | UCP1; uncoupling protein 1 (mitochondrial, proton carrier); UCP; mitochondrial brown fat uncoupling protein 1; SLC25A7; thermogenin; solute carrier family 25 member 7; |
Gene ID | 7350 |
mRNA Refseq | NM_021833 |
Protein Refseq | NP_068605 |
MIM | 113730 |
UniProt ID | P25874 |
Chromosome Location | 4q28-q31 |
Pathway | Adipogenesis, organism-specific biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Metabolism, organism-specific biosystem; Mitochondrial Uncoupling Proteins, organism-specific biosystem; PPAR signaling pathway, organism-specific biosystem; |
Function | anion transmembrane transporter activity; oxidative phosphorylation uncoupler activity; |
◆ Cell & Tissue Lysates | ||
UCP1-526HCL | Recombinant Human UCP1 293 Cell Lysate, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UCP1 Products
Required fields are marked with *
My Review for All UCP1 Products
Required fields are marked with *
0
Inquiry Basket