Recombinant Human UCP1 Protein (2-307 aa), His-SUMO-tagged
Cat.No. : | UCP1-846H |
Product Overview : | Recombinant Human UCP1 Protein (2-307 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-307 aa |
Description : | UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial mbrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 48.9 kDa |
AA Sequence : | GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | UCP1 uncoupling protein 1 (mitochondrial, proton carrier) [ Homo sapiens ] |
Official Symbol | UCP1 |
Synonyms | UCP1; UCP; SLC25A7; |
Gene ID | 7350 |
mRNA Refseq | NM_021833 |
Protein Refseq | NP_068605 |
MIM | 113730 |
UniProt ID | P25874 |
◆ Cell & Tissue Lysates | ||
UCP1-526HCL | Recombinant Human UCP1 293 Cell Lysate, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UCP1 Products
Required fields are marked with *
My Review for All UCP1 Products
Required fields are marked with *
0
Inquiry Basket