Recombinant Human UBTD2 Protein, GST-tagged
Cat.No. : | UBTD2-2417H |
Product Overview : | Human DC-UbP full-length ORF ( AAH19910, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-190 a.a. |
Description : | UBTD2 (Ubiquitin Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBTD1. |
Molecular Mass : | 46.64 kDa |
AA Sequence : | MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UBTD2 ubiquitin domain containing 2 [ Homo sapiens ] |
Official Symbol | UBTD2 |
Synonyms | UBTD2; ubiquitin domain containing 2; ubiquitin domain-containing protein 2; DC UbP; dendritic cell derived ubiquitin like protein; MGC30022; ubiquitin-like protein SB72; DCUBP; |
Gene ID | 92181 |
mRNA Refseq | NM_152277 |
Protein Refseq | NP_689490 |
MIM | 610174 |
UniProt ID | Q8WUN7 |
◆ Recombinant Proteins | ||
UBTD2-3564H | Recombinant Human UBTD2, GST-tagged | +Inquiry |
UBTD2-818Z | Recombinant Zebrafish UBTD2 | +Inquiry |
UBTD2-110H | Recombinant Human UBTD2 protein, His-tagged | +Inquiry |
UBTD2-5082R | Recombinant Rhesus monkey UBTD2 Protein, His-tagged | +Inquiry |
UBTD2-9862M | Recombinant Mouse UBTD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBTD2-542HCL | Recombinant Human UBTD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBTD2 Products
Required fields are marked with *
My Review for All UBTD2 Products
Required fields are marked with *
0
Inquiry Basket