Recombinant Human UBE2B Protein, His-tagged

• Cat.No.: UBE2B-615H
• Product Overview: Recombinant Human UBE2B fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution.
• Source: HEK293 cells
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 µM filtered solution of 25mM Tris, pH 7.5
• Molecular Mass: 18.3kD
• AA Sequence: MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDSLDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: UBE2B ubiquitin-conjugating enzyme E2B [ Homo sapiens ]
• Official Symbol: UBE2B
• Synonyms: UBE2B; ubiquitin-conjugating enzyme E2B; ubiquitin conjugating enzyme E2B (RAD6 homolog); ubiquitin-conjugating enzyme E2 B; HHR6B; RAD6B; UBC2; E2 protein; RAD6 homolog B; ubiquitin-protein ligase B; ubiquitin carrier protein B; ubiquitin-conjugating enzyme E2-17 kDa; ubiquitin-conjugating enzyme E2B (RAD6 homolog); HR6B; E2-17kDa
• Gene ID: 7320
• mRNA Refseq: NM_003337
• Protein Refseq: NP_003328
• MIM: 179095
• UniProt ID: P63146