Recombinant Human UBD Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBD-2247H |
Product Overview : | UBD MS Standard C13 and N15-labeled recombinant protein (NP_006389) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein which contains two ubiquitin-like domains and appears to have similar function to ubiquitin. Through covalent attachment, the encoded protein targets other proteins for 26S proteasome degradation. This protein has been implicated to function in many cellular processes, including caspase-dependent apoptosis, formation of aggresomes, mitotic regulation, and dendritic cell maturation. Upregulation of this gene may promote inflammation in chronic kidney disease and has been observed in many cancer types. |
Molecular Mass : | 18.5 kDa |
AA Sequence : | MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBD ubiquitin D [ Homo sapiens (human) ] |
Official Symbol | UBD |
Synonyms | UBD; ubiquitin D; FAT10; diubiquitin; ubiquitin-like protein FAT10; UBD-3; GABBR1; |
Gene ID | 10537 |
mRNA Refseq | NM_006398 |
Protein Refseq | NP_006389 |
MIM | 606050 |
UniProt ID | O15205 |
◆ Recombinant Proteins | ||
UBD-1213H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
UBD-6392R | Recombinant Rat UBD Protein | +Inquiry |
UBD-849H | Recombinant Human Ubiquitin D, His-tagged | +Inquiry |
UBD-6048R | Recombinant Rat UBD Protein, His (Fc)-Avi-tagged | +Inquiry |
UBD-936H | Recombinant Human UBD Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *
0
Inquiry Basket