Recombinant Human UBD, His-tagged

• Cat.No.: UBD-28355TH
• Product Overview: Recombinant full-length Human Diubiquitin with a N terminal His tag. 188 amino acids with a predicted MWt 20.9 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 165 amino acids
• Description: Universal Publishers produce the ubiquitous UBD and Gregorys street directories in Australia. The names of these publications have come to be used as a generic term for street directories in many Australian cities.
• Conjugation: HIS
• Molecular Weight: 20.900kDa inclusive of tags
• Tissue specificity: Constitutively expressed in mature dendritic cells and B cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG
• Sequence Similarities: Contains 2 ubiquitin-like domains.

Gene Information

• Gene Name: UBD ubiquitin D [ Homo sapiens ]
• Official Symbol: UBD
• Synonyms: UBD; ubiquitin D; FAT10
• Gene ID: 10537
• mRNA Refseq: NM_006398
• Protein Refseq: NP_006389
• MIM: 606050
• Uniprot ID: O15205
• Chromosome Location: 6p21.3
• Function: proteasome binding; protein binding