Recombinant Human UBALD2 Protein, GST-tagged

• Cat.No.: UBALD2-3660H
• Product Overview: Human FAM100B full-length ORF ( ABW03765.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: UBALD2 (UBA Like Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBALD1.
• Molecular Mass: 44.44 kDa
• AA Sequence: MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBALD2 UBA like domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: UBALD2
• Synonyms: UBALD2; UBA like domain containing 2; FAM100B family with sequence similarity 100, member B; UBA Like Domain Containing 2; Family With Sequence Similarity 100, Member B; FAM100B; UBA-Like Domain-Containing Protein 2; UBA-Like Domain Containing 2; Protein FAM100B
• Gene ID: 283991
• mRNA Refseq: NM_182565
• Protein Refseq: NP_872371
• UniProt ID: Q8IYN6