Recombinant Human TYK2

• Cat.No.: TYK2-31641TH
• Product Overview: Recombinant fragment of Human TYK2 with a proprietary tag: predicted molecular weight 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA
• Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.Contains 1 FERM domain.Contains 1 protein kinase domain.Contains 1 SH2 domain.

Gene Information

• Gene Name: TYK2 tyrosine kinase 2 [ Homo sapiens ]
• Official Symbol: TYK2
• Synonyms: TYK2; tyrosine kinase 2; non-receptor tyrosine-protein kinase TYK2; JTK1
• Gene ID: 7297
• mRNA Refseq: NM_003331
• Protein Refseq: NP_003322
• MIM: 176941
• Uniprot ID: P29597
• Chromosome Location: 19p13.2
• Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem
• Function: ATP binding; growth hormone receptor binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein tyrosine kinase activity